SCOP 1.55: Domain d1cxzb_: 1cxz B:

Lineage for d1cxzb_ (1cxz B:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.6: Effector domain of the protein kinase pkn/prk1 [46585] (1 family)

5. Family a.2.6.1: Effector domain of the protein kinase pkn/prk1 [46586] (1 protein)
   this is a repeat family; one repeat unit is 1urf A:122-199 found in domain

6. Protein Effector domain of the protein kinase pkn/prk1 [46587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46588] (1 PDB entry)

8. Domain d1cxzb_: 1cxz B: [15705]
   Other proteins in same PDB: d1cxza_

Details for d1cxzb_

PDB Entry: 1cxz, 2.2 Å

PDB Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1

SCOP Domain Sequences for d1cxzb_:

Sequence; same for both SEQRES and ATOM records:

>d1cxzb_ a.2.6.1 (B:) Effector domain of the protein kinase pkn/prk1 {Human (Homo sapiens)}
wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp
velllrgssrrldllhqqlqelhahv

Timeline for d1cxzb_:

• d1cxzb_ appears in SCOP 1.57
  
• d1cxzb_ appears in the current release, SCOPe 2.08