Lineage for d5lbvb2 (5lbv B:304-403)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766609Species Zika virus [TaxId:64320] [317280] (7 PDB entries)
  8. 2766611Domain d5lbvb2: 5lbv B:304-403 [319381]
    Other proteins in same PDB: d5lbva1, d5lbvb1
    automated match to d4gsxa2
    complexed with na

Details for d5lbvb2

PDB Entry: 5lbv (more details), 2.2 Å

PDB Description: structural basis of zika and dengue virus potent antibody cross- neutralization
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d5lbvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lbvb2 b.1.18.0 (B:304-403) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrs

SCOPe Domain Coordinates for d5lbvb2:

Click to download the PDB-style file with coordinates for d5lbvb2.
(The format of our PDB-style files is described here.)

Timeline for d5lbvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lbvb1