![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (55 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [317280] (5 PDB entries) |
![]() | Domain d5lbvb2: 5lbv B:304-403 [319381] Other proteins in same PDB: d5lbva1, d5lbvb1 automated match to d4gsxa2 complexed with bma, fuc, man, na, nag |
PDB Entry: 5lbv (more details), 2.2 Å
SCOPe Domain Sequences for d5lbvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lbvb2 b.1.18.0 (B:304-403) automated matches {Zika virus [TaxId: 64320]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp vitestenskmmleldppfgdsyivigvgekkithhwhrs
Timeline for d5lbvb2: