SCOPe 2.07: Domain d5lbvb2: 5lbv B:304-403

Lineage for d5lbvb2 (5lbv B:304-403)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317280] (7 PDB entries)

8. Domain d5lbvb2: 5lbv B:304-403 [319381]
   Other proteins in same PDB: d5lbva1, d5lbvb1
   automated match to d4gsxa2
   complexed with bma, fuc, man, na, nag

Details for d5lbvb2

PDB Entry: 5lbv, 2.2 Å

PDB Description: structural basis of zika and dengue virus potent antibody cross- neutralization

PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d5lbvb2:

Sequence; same for both SEQRES and ATOM records:

>d5lbvb2 b.1.18.0 (B:304-403) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrs

Timeline for d5lbvb2:

• d5lbvb2 first appeared in SCOPe 2.06
  
• d5lbvb2 appears in the current release, SCOPe 2.08