Lineage for d5jr3a1 (5jr3 A:11-99)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306463Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 protein domains)
    unknown function
  6. 2306479Protein Carminomycin 4-O-methyltransferase [109667] (1 species)
  7. 2306480Species Streptomyces peucetius [TaxId:1950] [109668] (6 PDB entries)
    Uniprot Q06528
  8. 2306486Domain d5jr3a1: 5jr3 A:11-99 [318057]
    Other proteins in same PDB: d5jr3a2, d5jr3b2, d5jr3c2
    automated match to d1tw2b1
    complexed with 4mu, sah, so4

Details for d5jr3a1

PDB Entry: 5jr3 (more details), 1.84 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with sah and 4-methylumbelliferone
PDB Compounds: (A:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5jr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jr3a1 a.4.5.29 (A:11-99) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
pqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlir
hlvaiglleedapgefvptevgelladdh

SCOPe Domain Coordinates for d5jr3a1:

Click to download the PDB-style file with coordinates for d5jr3a1.
(The format of our PDB-style files is described here.)

Timeline for d5jr3a1: