Lineage for d5jr3b2 (5jr3 B:100-352)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893124Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2893140Protein Carminomycin 4-O-methyltransferase [110660] (1 species)
  7. 2893141Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries)
    Uniprot Q06528
  8. 2893146Domain d5jr3b2: 5jr3 B:100-352 [318018]
    Other proteins in same PDB: d5jr3a1, d5jr3b1, d5jr3c1
    automated match to d1tw2b2
    complexed with 4mu, sah, so4

Details for d5jr3b2

PDB Entry: 5jr3 (more details), 1.84 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with sah and 4-methylumbelliferone
PDB Compounds: (B:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5jr3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jr3b2 c.66.1.12 (B:100-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapa

SCOPe Domain Coordinates for d5jr3b2:

Click to download the PDB-style file with coordinates for d5jr3b2.
(The format of our PDB-style files is described here.)

Timeline for d5jr3b2: