SCOPe 2.08: Domain d5jr3c1: 5jr3 C:10-99

Lineage for d5jr3c1 (5jr3 C:10-99)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Carminomycin 4-O-methyltransferase [109667] (1 species)

7. Species Streptomyces peucetius [TaxId:1950] [109668] (6 PDB entries)
   Uniprot Q06528

8. Domain d5jr3c1: 5jr3 C:10-99 [318006]
   Other proteins in same PDB: d5jr3a2, d5jr3b2, d5jr3c2
   automated match to d1tw2b1
   complexed with 4mu, sah, so4

Details for d5jr3c1

PDB Entry: 5jr3, 1.84 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with sah and 4-methylumbelliferone

PDB Compounds: (C:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5jr3c1:

Sequence; same for both SEQRES and ATOM records:

>d5jr3c1 a.4.5.29 (C:10-99) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
rpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli
rhlvaiglleedapgefvptevgelladdh

Timeline for d5jr3c1:

• d5jr3c1 first appeared in SCOPe 2.06
  
• d5jr3c1 appears in SCOPe 2.07