![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
![]() | Protein Carminomycin 4-O-methyltransferase [109667] (1 species) |
![]() | Species Streptomyces peucetius [TaxId:1950] [109668] (6 PDB entries) Uniprot Q06528 |
![]() | Domain d1tw2b1: 1tw2 B:3-98 [107371] Other proteins in same PDB: d1tw2a2, d1tw2b2 complexed with ert, sah |
PDB Entry: 1tw2 (more details), 2.5 Å
SCOPe Domain Sequences for d1tw2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw2b1 a.4.5.29 (B:3-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} eptvaarpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpe allrlirhlvaiglleedapgefvptevgelladdh
Timeline for d1tw2b1: