SCOPe 2.08: Domain d5d9ja1: 5d9j A:1-177

Lineage for d5d9ja1 (5d9j A:1-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (8 species)

7. Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)

8. Domain d5d9ja1: 5d9j A:1-177 [316594]
   Other proteins in same PDB: d5d9ja2
   automated match to d4e5ed_
   complexed with 0n8, mn; mutant

Details for d5d9ja1

PDB Entry: 5d9j, 1.85 Å

PDB Description: 2009 h1n1 pa endonuclease mutant f105s in complex with l-742,001

PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5d9ja1:

Sequence; same for both SEQRES and ATOM records:

>d5d9ja1 c.52.1.34 (A:1-177) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkslpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser

Timeline for d5d9ja1:

• d5d9ja1 first appeared in SCOPe 2.06
  
• d5d9ja1 appears in SCOPe 2.07