SCOPe 2.08: Domain d1c30a2: 1c30 A:936-1073

Lineage for d1c30a2 (1c30 A:936-1073)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)

6. Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)

7. Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
   Uniprot P00968

8. Domain d1c30a2: 1c30 A:936-1073 [31483]
   Other proteins in same PDB: d1c30a1, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2
   complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30a2

PDB Entry: 1c30, 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

PDB Compounds: (A:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c30a2:

Sequence; same for both SEQRES and ATOM records:

>d1c30a2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

Timeline for d1c30a2:

• d1c30a2 first appeared (with stable ids) in SCOP 1.55
  
• d1c30a2 appears in SCOPe 2.07