Lineage for d1c30g1 (1c30 G:403-555)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719912Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 2719913Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
    automatically mapped to Pfam PF02787
  5. 2719914Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 2719915Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 2719916Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
    Uniprot P00968
  8. 2719936Domain d1c30g1: 1c30 G:403-555 [18557]
    Other proteins in same PDB: d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30g1

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s
PDB Compounds: (G:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c30g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30g1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOPe Domain Coordinates for d1c30g1:

Click to download the PDB-style file with coordinates for d1c30g1.
(The format of our PDB-style files is described here.)

Timeline for d1c30g1: