Lineage for d1c30h2 (1c30 H:153-380)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858762Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 2858763Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
    Uniprot P00907
  8. 2858783Domain d1c30h2: 1c30 H:153-380 [31416]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30h2

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s
PDB Compounds: (H:) carbamoyl phosphate synthetase: small subunit

SCOPe Domain Sequences for d1c30h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30h2 c.23.16.1 (H:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgislgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOPe Domain Coordinates for d1c30h2:

Click to download the PDB-style file with coordinates for d1c30h2.
(The format of our PDB-style files is described here.)

Timeline for d1c30h2: