Lineage for d1c30a6 (1c30 A:677-935)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978615Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 2978616Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
    Uniprot P00968
  8. 2978650Domain d1c30a6: 1c30 A:677-935 [41511]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30b1, d1c30b2, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30d1, d1c30d2, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30f1, d1c30f2, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30h1, d1c30h2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30a6

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s
PDB Compounds: (A:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c30a6:

Sequence, based on SEQRES records: (download)

>d1c30a6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1c30a6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOPe Domain Coordinates for d1c30a6:

Click to download the PDB-style file with coordinates for d1c30a6.
(The format of our PDB-style files is described here.)

Timeline for d1c30a6: