Lineage for d1c30g2 (1c30 G:936-1073)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859567Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 2859568Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 2859569Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
    Uniprot P00968
  8. 2859589Domain d1c30g2: 1c30 G:936-1073 [31486]
    Other proteins in same PDB: d1c30a1, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30g2

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s
PDB Compounds: (G:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c30g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30g2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOPe Domain Coordinates for d1c30g2:

Click to download the PDB-style file with coordinates for d1c30g2.
(The format of our PDB-style files is described here.)

Timeline for d1c30g2: