SCOPe 2.08: Domain d5ezha1: 5ezh A:22-94

Lineage for d5ezha1 (5ezh A:22-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83331] [313822] (25 PDB entries)

8. Domain d5ezha1: 5ezh A:22-94 [313837]
   Other proteins in same PDB: d5ezha2
   automated match to d1t56a1
   complexed with 841, so4

Details for d5ezha1

PDB Entry: 5ezh, 1.7 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 21 at 1.7a resolution

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5ezha1:

Sequence; same for both SEQRES and ATOM records:

>d5ezha1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d5ezha1:

• d5ezha1 first appeared in SCOPe 2.06
  
• d5ezha1 appears in SCOPe 2.07