| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (22 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83331] [313822] (9 PDB entries) |
| Domain d5ezha1: 5ezh A:22-94 [313837] Other proteins in same PDB: d5ezha2 automated match to d1t56a1 complexed with 841, so4 |
PDB Entry: 5ezh (more details), 1.7 Å
SCOPe Domain Sequences for d5ezha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ezha1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp
Timeline for d5ezha1: