Lineage for d1srrc_ (1srr C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) 
Protein Sporulation response regulator Spo0F [52188] (1 species) Species Bacillus subtilis [TaxId:1423] [52189] (5 PDB entries) 
Domain d1srrc_: 1srr C: [31112]
Details for d1srrc_
PDB Entry: 1srr (more details), 1.9 Å
PDB Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis
SCOP Domain Sequences for d1srrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1srrc_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis}
mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
k
SCOP Domain Coordinates for d1srrc_:
Click to download the PDB-style file with coordinates for d1srrc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1srrc_:
- d1srrc_ appears in SCOP 1.57
- d1srrc_ appears in the current release, SCOPe 2.08
View in 3D
