Lineage for d1srrc_ (1srr C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 protein domains)
  6. 21856Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 21857Species Bacillus subtilis [TaxId:1423] [52189] (5 PDB entries)
  8. 21860Domain d1srrc_: 1srr C: [31112]

Details for d1srrc_

PDB Entry: 1srr (more details), 1.9 Å

PDB Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis

SCOP Domain Sequences for d1srrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srrc_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis}
mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
k

SCOP Domain Coordinates for d1srrc_:

Click to download the PDB-style file with coordinates for d1srrc_.
(The format of our PDB-style files is described here.)

Timeline for d1srrc_: