PDB entry 1srr

View 1srr on RCSB PDB site
Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis
Deposited on 1996-04-10, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1srra_
  • Chain 'B':
    Domains in SCOP 1.55: d1srrb_
  • Chain 'C':
    Domains in SCOP 1.55: d1srrc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srrA (A:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srrB (B:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylplk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srrC (C:)
    mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
    gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    k