Lineage for d1srrc_ (1srr C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68134Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 68135Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 68221Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 68222Species Bacillus subtilis [TaxId:1423] [52189] (5 PDB entries)
  8. 68232Domain d1srrc_: 1srr C: [31112]

Details for d1srrc_

PDB Entry: 1srr (more details), 1.9 Å

PDB Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis

SCOP Domain Sequences for d1srrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srrc_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis}
mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
k

SCOP Domain Coordinates for d1srrc_:

Click to download the PDB-style file with coordinates for d1srrc_.
(The format of our PDB-style files is described here.)

Timeline for d1srrc_: