SCOPe 2.07: Domain d4rkuf_: 4rku F:

Lineage for d4rkuf_ (4rku F:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276202] (7 PDB entries)

8. Domain d4rkuf_: 4rku F: [309468]
   Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuj_
   automated match to d4y28f_
   complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkuf_

PDB Entry: 4rku, 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution

PDB Compounds: (F:) photosystem I reaction center subunit III, chloroplastic

SCOPe Domain Sequences for d4rkuf_:

Sequence; same for both SEQRES and ATOM records:

>d4rkuf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
sgltpckeskqfakrekqsikklesslkiyaadsapalainatiektkrrfdnyakqgll
cgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeiiid
vplasrlvfrgfswpiaayrellngelvakdv

Timeline for d4rkuf_:

• d4rkuf_ first appeared in SCOPe 2.06
  
• d4rkuf_ appears in the current release, SCOPe 2.08