Lineage for d4rkuc_ (4rku C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556036Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries)
  8. 2556044Domain d4rkuc_: 4rku C: [309465]
    Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_
    automated match to d4y28c_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkuc_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d4rkuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkuc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d4rkuc_:

Click to download the PDB-style file with coordinates for d4rkuc_.
(The format of our PDB-style files is described here.)

Timeline for d4rkuc_: