PDB entry 4rku

View 4rku on RCSB PDB site
Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
Class: photosynthesis
Keywords: light harvesting, membrane complex, plastocyanin, ferredoxin, chloroplast membrane, PHOTOSYNTHESIS
Deposited on 2014-10-14, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.259
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Chlorophyll a-b binding protein 6A, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-181)
    Domains in SCOPe 2.07: d4rku1_
  • Chain '2':
    Compound: Type II chlorophyll a/b binding protein from photosystem I
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Chlorophyll a-b binding protein 3, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rku3_
  • Chain '4':
    Compound: chlorophyll a-b binding protein p4, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SQL2 (0-195)
      • conflict (75)
      • conflict (96)
    Domains in SCOPe 2.07: d4rku4_
  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05310 (0-720)
      • conflict (79)
      • conflict (589)
      • conflict (601)
    Domains in SCOPe 2.07: d4rkua_
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05311 (0-730)
      • conflict (9)
      • conflict (270)
      • conflict (468)
      • conflict (473-474)
      • conflict (480)
      • conflict (488)
      • conflict (600)
      • conflict (632)
    Domains in SCOPe 2.07: d4rkub_
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rkuc_
  • Chain 'D':
    Compound: photosystem I reaction center subunit II, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-136)
    Domains in SCOPe 2.07: d4rkud_
  • Chain 'E':
    Compound: Photosystem I reaction center subunit IV B, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-62)
    Domains in SCOPe 2.07: d4rkue_
  • Chain 'F':
    Compound: photosystem I reaction center subunit III, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-151)
    Domains in SCOPe 2.07: d4rkuf_
  • Chain 'G':
    Compound: photosystem I reaction center subunit v, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-83)
  • Chain 'H':
    Compound: photosystem I reaction center subunit vi, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-81)
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rkuj_
  • Chain 'K':
    Compound: Photosystem I reaction center subunit X psaK
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C9L3 (0-71)
      • conflict (5)
      • conflict (8)
      • conflict (12)
      • conflict (15)
      • conflict (41)
      • conflict (64)
  • Chain 'L':
    Compound: photosystem I reaction center subunit xi, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4RKU (0-162)
  • Chain 'N':
    Compound: Photosystem I-N subunit
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C9K7 (0-84)
      • conflict (0)
      • conflict (2-4)
      • conflict (11)
      • conflict (24)
      • conflict (35)
      • conflict (38)
      • conflict (60)
      • conflict (62)
      • conflict (65)
      • conflict (74)
  • Heterogens: PQN, BCR, LHG, CLA, SF4, CL0, DGD, LMG, LUT, NEX, G3P

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >4rku1 (1:)
    prpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpealglgnw
    vkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkkypggaf
    dplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathladpwhnn
    ig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rku1 (1:)
    prpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpealglgnw
    vkaqewaalvpwgtlptilvieflsiafvehqrsmekdpekkkypggafdplgyskdpkk
    fheykikevkngrlallafvgicvqqsaypgtgplenlathladpwhnnig
    

  • Chain '2':
    No sequence available.

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >4rku3 (3:)
    matqalvssssltfaaeavrqsfrarslpssvgcsrkglvraaatppvkqggvdrplwfa
    skqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgavgaiape
    ylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfqdwakpg
    smgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrlamlailg
    yfiqglvtgvgpyqnlldhvadpvnnnvltslkfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rku3 (3:)
    glsdpegtggfieprwlaygevingrfamlgavgaiapeylgkvggtynywadnytlfvl
    emalmgfaehrrfqdwakpgsmgkgnpaypggpffnplgfgkdekslkelklkevkngrl
    amlailgyfiqglvtgvgpyqnlldhvadpv
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rku4 (4:)
    kgewlpglaspgyltgslpgdngfdplglaedpenlrwfvqaelvngrwamlgvagmllp
    evftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpif
    kqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfdn
    llqhisdpwhntivqt
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuA (A:)
    ghfsrtiakgpdtttwiwnlhadahdfdshtsdleeisrkvfsahfgqlsiiflwlsgmy
    fhgarfsnyeawlndpthirpsaqvvwpivgqeilngdvgggfrgiqitsgffqiwrasg
    itselqlyctaigalvfaglmlfagwfhyhkaapklawfqdvesmlnhhlagllglgsls
    warhqvhvslpinqflnagvdpkeiplphefilnrdllaqlypsfaegatpfftlnwsky
    adfltfrggldpltgglwltdiahhhlaiailfliaghmyrtnwgighgikdileahkgp
    ftgqghkglyeilttswhaqlsinlamlgsltivvaqhmysmppypylatdyatqlslft
    hhmwiggflivgaaahaaifmvrdydpttryndlldrvlrhrdaiishlnwvciflgfhs
    fglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnthalapgttapgatastsltwgg
    gdlvavgnkvallpiplgtadflvhhihaftihvtvlillkgvlfarssrlipdkanlgf
    rfpcdgpgrggtcqvsawdhvflglfwmynsisvvifhfswkmqsdvwgsindqgvvthi
    tggnfaqssitingwlrdflwaqasqviqsygsslsayglfflgahfvwafslmflfsgr
    gywqeliesivwahnklkvapatqpralsivqgravgvthyllggiattwafflariiav
    g
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuB (B:)
    lriprfsqglaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwts
    gnlfhvawqgnfeawvqdpfhvrpiahaiwdphfgqpaveaftrggalgpvnnaysgvyq
    wwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsgl
    fgvsslawaghlvhvaipgsrgeyvrwnnfldvlpypqglgplltgqwnlyaqnpsssnh
    lfgttqgagtailtilggfhpqtqslwltdmahhhlaiaflfligglmyrtnfgighsik
    yileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafia
    qdfttqaalythhqyiagfimtgafahgpiffirdynpeqnadnvlarmlehkeaiishl
    swaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsstn
    spalnagrsiwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgaldar
    gsklmpdkkdfgysfpcdgpgrggtcdisawddfylavfwmlntigwvtfywhwkhitlw
    qgnvsqfnesstylmgwlrdylwlnssqlingytplvcnslsvwawmflfghlvwatgfm
    fliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyiftya
    afliastsgkf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuC (C:)
    shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
    flsvrvylwhettrsmglay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuD (D:)
    tppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnll
    klarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfr
    sigknvspievkftgkq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuE (E:)
    pigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyalde
    vee
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuF (F:)
    sgltpckeskqfakrekqsikklesslkiyaadsapalainatiektkrrfdnyakqgll
    cgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeiiid
    vplasrlvfrgfswpiaayrellngelvakdv
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkuJ (J:)
    rdlktylsvapvastlwfaalagllieinrlfpdaltfpf
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'N':
    No sequence available.