![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
![]() | Protein automated matches [191237] (6 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [311431] (7 PDB entries) |
![]() | Domain d4rkue_: 4rku E: [309467] Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkuf_, d4rkuj_ automated match to d4y28e_ complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4 |
PDB Entry: 4rku (more details), 3 Å
SCOPe Domain Sequences for d4rkue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rkue_ b.34.4.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} pigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyalde vee
Timeline for d4rkue_: