Lineage for d4rkua_ (4rku A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633204Family f.29.1.0: automated matches [310681] (1 protein)
    not a true family
  6. 2633205Protein automated matches [310892] (1 species)
    not a true protein
  7. 2633206Species Pea (Pisum sativum) [TaxId:3888] [311429] (1 PDB entry)
  8. 2633207Domain d4rkua_: 4rku A: [309463]
    Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_
    automated match to d4y28b_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkua_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d4rkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkua_ f.29.1.0 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
ghfsrtiakgpdtttwiwnlhadahdfdshtsdleeisrkvfsahfgqlsiiflwlsgmy
fhgarfsnyeawlndpthirpsaqvvwpivgqeilngdvgggfrgiqitsgffqiwrasg
itselqlyctaigalvfaglmlfagwfhyhkaapklawfqdvesmlnhhlagllglgsls
warhqvhvslpinqflnagvdpkeiplphefilnrdllaqlypsfaegatpfftlnwsky
adfltfrggldpltgglwltdiahhhlaiailfliaghmyrtnwgighgikdileahkgp
ftgqghkglyeilttswhaqlsinlamlgsltivvaqhmysmppypylatdyatqlslft
hhmwiggflivgaaahaaifmvrdydpttryndlldrvlrhrdaiishlnwvciflgfhs
fglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnthalapgttapgatastsltwgg
gdlvavgnkvallpiplgtadflvhhihaftihvtvlillkgvlfarssrlipdkanlgf
rfpcdgpgrggtcqvsawdhvflglfwmynsisvvifhfswkmqsdvwgsindqgvvthi
tggnfaqssitingwlrdflwaqasqviqsygsslsayglfflgahfvwafslmflfsgr
gywqeliesivwahnklkvapatqpralsivqgravgvthyllggiattwafflariiav
g

SCOPe Domain Coordinates for d4rkua_:

Click to download the PDB-style file with coordinates for d4rkua_.
(The format of our PDB-style files is described here.)

Timeline for d4rkua_: