SCOPe 2.08: Domain d1ddcd_: 1ddc D:

Lineage for d1ddcd_ (1ddc D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (12 species)
   not a true protein

7. Species Desulfovibrio desulfuricans [311126] (1 PDB entry)

8. Domain d1ddcd_: 1ddc D: [302325]
   automated match to d1h21a_
   complexed with hem

Details for d1ddcd_

PDB Entry: 1ddc, 2.5 Å

PDB Description: dimeric di-heme split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774

PDB Compounds: (D:) split-soret cytochrome c

SCOPe Domain Sequences for d1ddcd_:

Sequence, based on SEQRES records:

>d1ddcd_ a.138.1.3 (D:) automated matches {Desulfovibrio desulfuricans}
rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh

Sequence, based on observed residues (ATOM records):

>d1ddcd_ a.138.1.3 (D:) automated matches {Desulfovibrio desulfuricans}
rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh

Timeline for d1ddcd_:

• d1ddcd_ first appeared in SCOPe 2.06
  
• d1ddcd_ appears in SCOPe 2.07