Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Dimeric di-heme split-soret cytochrome c [48716] (1 species) |
Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48717] (1 PDB entry) |
Domain d1h21a_: 1h21 A: [76510] complexed with hec |
PDB Entry: 1h21 (more details), 2.5 Å
SCOPe Domain Sequences for d1h21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h21a_ a.138.1.3 (A:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]} grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp
Timeline for d1h21a_: