Lineage for d1h21a_ (1h21 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734347Protein Dimeric di-heme split-soret cytochrome c [48716] (1 species)
  7. 2734348Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48717] (1 PDB entry)
  8. 2734349Domain d1h21a_: 1h21 A: [76510]
    complexed with hec

Details for d1h21a_

PDB Entry: 1h21 (more details), 2.5 Å

PDB Description: a novel iron centre in the split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) split-soret cytochrome c

SCOPe Domain Sequences for d1h21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h21a_ a.138.1.3 (A:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}
grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp

SCOPe Domain Coordinates for d1h21a_:

Click to download the PDB-style file with coordinates for d1h21a_.
(The format of our PDB-style files is described here.)

Timeline for d1h21a_: