Lineage for d1ddca_ (1ddc A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. Protein automated matches [190276] (12 species)
    not a true protein
  7. Species Desulfovibrio desulfuricans [311126] (1 PDB entry)
  8. Domain d1ddca_: 1ddc A: [302322]
    automated match to d1h21a_
    complexed with hem

Details for d1ddca_

PDB Entry: 1ddc (more details), 2.5 Å

PDB Description: dimeric di-heme split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) split-soret cytochrome c

SCOPe Domain Sequences for d1ddca_:

Sequence, based on SEQRES records: (download)

>d1ddca_ a.138.1.3 (A:) automated matches {Desulfovibrio desulfuricans}
rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh

Sequence, based on observed residues (ATOM records): (download)

>d1ddca_ a.138.1.3 (A:) automated matches {Desulfovibrio desulfuricans}
rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh

SCOPe Domain Coordinates for d1ddca_ are not available.

Timeline for d1ddca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ddcb_, d1ddcc_, d1ddcd_