![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (8 species) |
![]() | Species Thermococcus litoralis [TaxId:2265] [51887] (1 PDB entry) |
![]() | Domain d1bvub1: 1bvu B:181-418 [30227] Other proteins in same PDB: d1bvua2, d1bvub2, d1bvuc2, d1bvud2, d1bvue2, d1bvuf2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1bvu (more details), 2.5 Å
SCOPe Domain Sequences for d1bvub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvub1 c.2.1.7 (B:181-418) Glutamate dehydrogenase {Thermococcus litoralis [TaxId: 2265]} ggivarmdatargasytvreaakalgmdlkgktiaiqgygnagyymakimseeygmkvva vsdtkggiynpdglnadevlawkkktgsvkdfpgatnitneellelevdvlapsaieevi tkknadnikakivaelangpttpeadeilyekgiliipdflcnaggvtvsyfewvqnitg dywtveetrakldkkmtkafwdvynthkekninmrdaayvvavsrvyqamkdrgwikk
Timeline for d1bvub1: