Lineage for d1bvuc1 (1bvu C:181-418)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. Protein Glutamate dehydrogenase [51884] (8 species)
  7. Species Thermococcus litoralis [TaxId:2265] [51887] (1 PDB entry)
  8. Domain d1bvuc1: 1bvu C:181-418 [30228]
    Other proteins in same PDB: d1bvua2, d1bvub2, d1bvuc2, d1bvud2, d1bvue2, d1bvuf2

Details for d1bvuc1

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis
PDB Compounds: (C:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d1bvuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvuc1 c.2.1.7 (C:181-418) Glutamate dehydrogenase {Thermococcus litoralis [TaxId: 2265]}
ggivarmdatargasytvreaakalgmdlkgktiaiqgygnagyymakimseeygmkvva
vsdtkggiynpdglnadevlawkkktgsvkdfpgatnitneellelevdvlapsaieevi
tkknadnikakivaelangpttpeadeilyekgiliipdflcnaggvtvsyfewvqnitg
dywtveetrakldkkmtkafwdvynthkekninmrdaayvvavsrvyqamkdrgwikk

SCOPe Domain Coordinates for d1bvuc1 are not available.

Timeline for d1bvuc1:

Domains from same chain:
(mouse over for more information)
d1bvuc2
Domains from other chains:
(mouse over for more information)
d1bvua1, d1bvua2, d1bvub1, d1bvub2, d1bvud1, d1bvud2, d1bvue1, d1bvue2, d1bvuf1, d1bvuf2