Lineage for d1bvrb_ (1bvr B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686655Protein Enoyl-ACP reductase [51791] (6 species)
  7. 686727Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (19 PDB entries)
  8. 686763Domain d1bvrb_: 1bvr B: [29914]

Details for d1bvrb_

PDB Entry: 1bvr (more details), 2.8 Å

PDB Description: m.tb. enoyl-acp reductase (inha) in complex with nad+ and c16-fatty- acyl-substrate
PDB Compounds: (B:) protein (enoyl-acyl carrier protein (acp) reductase)

SCOP Domain Sequences for d1bvrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvrb_ c.2.1.2 (B:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d1bvrb_:

Click to download the PDB-style file with coordinates for d1bvrb_.
(The format of our PDB-style files is described here.)

Timeline for d1bvrb_: