Lineage for d1bvrb_ (1bvr B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20186Protein Enoyl-ACP reductase [51791] (3 species)
  7. 20212Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (4 PDB entries)
  8. 20217Domain d1bvrb_: 1bvr B: [29914]

Details for d1bvrb_

PDB Entry: 1bvr (more details), 2.8 Å

PDB Description: m.tb. enoyl-acp reductase (inha) in complex with nad+ and c16-fatty- acyl-substrate

SCOP Domain Sequences for d1bvrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvrb_ c.2.1.2 (B:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d1bvrb_:

Click to download the PDB-style file with coordinates for d1bvrb_.
(The format of our PDB-style files is described here.)

Timeline for d1bvrb_: