Lineage for d1krbb_ (1krb B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) 
Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) 
Family b.85.3.1: Urease, beta-subunit [51279] (1 protein) Protein Urease, beta-subunit [51280] (2 species) 
Species Klebsiella aerogenes [TaxId:28451] [51281] (25 PDB entries) 
Domain d1krbb_: 1krb B: [28342]
Other proteins in same PDB: d1krba_, d1krbc1, d1krbc2
Details for d1krbb_
PDB Entry: 1krb (more details), 2.5 Å
PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants
SCOP Domain Sequences for d1krbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1krbb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
SCOP Domain Coordinates for d1krbb_:
Click to download the PDB-style file with coordinates for d1krbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1krbb_:
- d1krbb_ appears in SCOP 1.57
- d1krbb_ appears in the current release, SCOPe 2.08
View in 3D
