Lineage for d1krbb_ (1krb B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18112Fold b.85: beta-clip [51268] (5 superfamilies)
  4. 18162Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 18163Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 18164Protein Urease, beta-subunit [51280] (2 species)
  7. 18170Species Klebsiella aerogenes [TaxId:28451] [51281] (25 PDB entries)
  8. 18193Domain d1krbb_: 1krb B: [28342]
    Other proteins in same PDB: d1krba_, d1krbc1, d1krbc2

Details for d1krbb_

PDB Entry: 1krb (more details), 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants

SCOP Domain Sequences for d1krbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krbb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOP Domain Coordinates for d1krbb_:

Click to download the PDB-style file with coordinates for d1krbb_.
(The format of our PDB-style files is described here.)

Timeline for d1krbb_: