![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
![]() | Protein Urease, beta-subunit [51280] (4 species) |
![]() | Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries) |
![]() | Domain d1krbb_: 1krb B: [28342] Other proteins in same PDB: d1krba_, d1krbc1, d1krbc2 complexed with ni; mutant |
PDB Entry: 1krb (more details), 2.5 Å
SCOPe Domain Sequences for d1krbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1krbb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]} mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d1krbb_: