Lineage for d1krbc1 (1krb C:2-129,C:423-475)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18307Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily)
  4. 18308Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family) (S)
  5. 18309Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein)
  6. 18310Protein alpha-Subunit of urease, composite domain [51340] (2 species)
  7. 18316Species Klebsiella aerogenes [TaxId:28451] [51341] (25 PDB entries)
  8. 18339Domain d1krbc1: 1krb C:2-129,C:423-475 [28418]
    Other proteins in same PDB: d1krba_, d1krbb_, d1krbc2

Details for d1krbc1

PDB Entry: 1krb (more details), 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants

SCOP Domain Sequences for d1krbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krbc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease, composite domain {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOP Domain Coordinates for d1krbc1:

Click to download the PDB-style file with coordinates for d1krbc1.
(The format of our PDB-style files is described here.)

Timeline for d1krbc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1krbc2