Lineage for d4xd3g_ (4xd3 G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833602Protein automated matches [190258] (3 species)
    not a true protein
  7. 2833606Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)
  8. 2833628Domain d4xd3g_: 4xd3 G: [280096]
    automated match to d1qw7a_
    complexed with cac, mpd, zn

Details for d4xd3g_

PDB Entry: 4xd3 (more details), 1.57 Å

PDB Description: phosphotriesterase variant e3
PDB Compounds: (G:) Phosphotriesterase variant PTE-E1

SCOPe Domain Sequences for d4xd3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xd3g_ c.1.9.3 (G:) automated matches {Brevundimonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
aifeseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasasafmg
irswqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvi
pflrekgipqetlagitvtnparflsptl

SCOPe Domain Coordinates for d4xd3g_:

Click to download the PDB-style file with coordinates for d4xd3g_.
(The format of our PDB-style files is described here.)

Timeline for d4xd3g_: