Lineage for d1qw7a_ (1qw7 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
automatically mapped to Pfam PF02126Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species) 
Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries)
Uniprot P0A434 30-365
Domain d1qw7a_: 1qw7 A: [111660]
complexed with co, ebp, na
Details for d1qw7a_
PDB Entry: 1qw7 (more details), 1.9 Å
PDB Description: structure of an engineered organophosphorous hydrolase with increased activity toward hydrolysis of phosphothiolate bonds
PDB Compounds: (A:) Parathion hydrolaseSCOPe Domain Sequences for d1qw7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qw7a_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
eqqaaifeseglspsrvcighsddtddlsyltalaargyligldriphsaiglednasas
allgirswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafip
lrvipflrekgvpqetlagitvtnparflsptlras
SCOPe Domain Coordinates for d1qw7a_:
Click to download the PDB-style file with coordinates for d1qw7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qw7a_:
- d1qw7a_ first appeared in SCOP 1.71
- d1qw7a_ appears in SCOPe 2.07
View in 3D
