Lineage for d1qw7a_ (1qw7 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572244Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 572318Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins)
  6. 572319Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (2 species)
  7. 572325Species Pseudomonas diminuta [TaxId:293] [51566] (10 PDB entries)
  8. 572335Domain d1qw7a_: 1qw7 A: [111660]

Details for d1qw7a_

PDB Entry: 1qw7 (more details), 1.9 Å

PDB Description: Structure of an Engineered Organophosphorous Hydrolase with Increased Activity Toward Hydrolysis of Phosphothiolate Bonds

SCOP Domain Sequences for d1qw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw7a_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta}
sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
eqqaaifeseglspsrvcighsddtddlsyltalaargyligldriphsaiglednasas
allgirswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafip
lrvipflrekgvpqetlagitvtnparflsptlras

SCOP Domain Coordinates for d1qw7a_:

Click to download the PDB-style file with coordinates for d1qw7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qw7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qw7b_