PDB entry 1qw7

View 1qw7 on RCSB PDB site
Description: Structure of an Engineered Organophosphorous Hydrolase with Increased Activity Toward Hydrolysis of Phosphothiolate Bonds
Class: hydrolase
Keywords: organophosphorous hydrolase, phosphotriesterase, VX, RVX, 4-methylbenzylphosphonate, mutant
Deposited on 2003-09-01, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-335)
      • engineered (224)
    Domains in SCOPe 2.07: d1qw7a_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-335)
      • engineered (224)
    Domains in SCOPe 2.07: d1qw7b_
  • Heterogens: CO, NA, EBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qw7A (A:)
    sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
    araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldriphsaiglednasas
    allgirswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qw7B (B:)
    sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
    araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldriphsaiglednasas
    allgirswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras