PDB entry 4xd3

View 4xd3 on RCSB PDB site
Description: Phosphotriesterase variant E1
Class: hydrolase
Keywords: dynamics, evolution, phosphotriesterase, HYDROLASE
Deposited on 2014-12-19, released 2015-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotriesterase variant PTE-E1
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xd3a_
  • Chain 'G':
    Compound: Phosphotriesterase variant PTE-E1
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xd3g_
  • Heterogens: ZN, CAC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xd3A (A:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaifeseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasasafm
    girswqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xd3A (A:)
    rintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraagv
    rtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflreiq
    ygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqaai
    feseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasasafmgir
    swqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipf
    lrekgipqetlagitvtnparflsptl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xd3G (G:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaifeseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasasafm
    girswqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xd3G (G:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
    aifeseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasasafmg
    irswqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvi
    pflrekgipqetlagitvtnparflsptl