SCOPe 2.08: Domain d1dlpa2: 1dlp A:116-235

Lineage for d1dlpa2 (1dlp A:116-235)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)

6. Protein Fetuin-binding protein Scafet precursor [51117] (1 species)
   duplication: consists of two beta-prism II domains

7. Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)

8. Domain d1dlpa2: 1dlp A:116-235 [28001]
   low resolution structure

Details for d1dlpa2

PDB Entry: 1dlp, 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin

PDB Compounds: (A:) lectin scafet precursor

SCOPe Domain Sequences for d1dlpa2:

Sequence, based on SEQRES records:

>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
gsvvvanngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstn
tagkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt

Sequence, based on observed residues (ATOM records):

>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
gsvvvanngnsilystndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstnta
gkgtgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt

Timeline for d1dlpa2:

• d1dlpa2 first appeared (with stable ids) in SCOP 1.55
  
• d1dlpa2 appears in SCOPe 2.07