Class b: All beta proteins [48724] (180 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins) |
Protein Fetuin-binding protein Scafet precursor [51117] (1 species) duplication: consists of two beta-prism II domains |
Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry) |
Domain d1dlpf1: 1dlp F:1-111 [28010] low resolution structure |
PDB Entry: 1dlp (more details), 3.3 Å
SCOPe Domain Sequences for d1dlpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlpf1 b.78.1.1 (F:1-111) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsg
Timeline for d1dlpf1: