SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1dlpc1 (1dlp C:1-115)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069078Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2069079Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2069080Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 protein domains)
  6. 2069081Protein Fetuin-binding protein Scafet precursor [51117] (1 species)
    duplication: consists of two beta-prism II domains
  7. 2069082Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)
  8. 2069087Domain d1dlpc1: 1dlp C:1-115 [28004]
    low resolution structure

Details for d1dlpc1

PDB Entry: 1dlp (more details), 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin
PDB Compounds: (C:) lectin scafet precursor

SCOPe Domain Sequences for d1dlpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlpc1 b.78.1.1 (C:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnk

SCOPe Domain Coordinates for d1dlpc1:

Click to download the PDB-style file with coordinates for d1dlpc1.
(The format of our PDB-style files is described here.)

Timeline for d1dlpc1: