PDB entry 1dlp

View 1dlp on RCSB PDB site
Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin
Class: sugar binding protein
Keywords: two-domain lectin, beta prism II fold, native, sugar binding protein
Deposited on 1999-12-11, released 2000-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin scafet precursor
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlpa1, d1dlpa2
  • Chain 'B':
    Compound: lectin scafet precursor
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlpb1, d1dlpb2
  • Chain 'C':
    Compound: lectin scafet precursor
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlpc1, d1dlpc2
  • Chain 'D':
    Compound: lectin scafet precursor
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlpd1, d1dlpd2
  • Chain 'E':
    Compound: lectin scafet precursor
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlpe1, d1dlpe2
  • Chain 'F':
    Compound: lectin scafet precursor
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlpf1, d1dlpf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dlpA (A:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkg
    tgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlpA (A:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkgtg
    cravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dlpB (B:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkg
    tgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlpB (B:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsngnsily
    stqnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagtgcravlqpngrmd
    vltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dlpC (C:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkg
    tgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlpC (C:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkgtg
    cravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dlpD (D:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkg
    tgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlpD (D:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnngnsil
    ystnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkgtgcravlqpngr
    mdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1dlpE (E:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkg
    tgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlpE (E:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkgtgcr
    avlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1dlpF (F:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsgtsnkgsvvv
    anngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkg
    tgcravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlpF (F:)
    nnilfglshegshpqtlhaaqslelssfrftmqsdcnlvlfdsdvrvwasntagatgcra
    vlqsdgllviltaqntirwssgtkgsignyvlvlqpdrtvtiygpglwdsggnsilystn
    hpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntgtgcravlqpngrmdvltnq
    niavwtsgnsrsagryvfvlqpdrnlaiyggalwtt