Lineage for d1dlpd2 (1dlp D:123-235)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)
  6. Protein Fetuin-binding protein Scafet precursor [51117] (1 species)
    duplication: consists of two beta-prism II domains
  7. Species Bluebell (Scilla campanulata) [TaxId:81759] [51118] (1 PDB entry)
  8. Domain d1dlpd2: 1dlp D:123-235 [28007]
    low resolution structure

Details for d1dlpd2

PDB Entry: 1dlp (more details), 3.3 Å

PDB Description: structural characterization of the native fetuin-binding protein scilla campanulata agglutinin (scafet): a novel two-domain lectin
PDB Compounds: (D:) lectin scafet precursor

SCOPe Domain Sequences for d1dlpd2:

Sequence, based on SEQRES records: (download)

>d1dlpd2 b.78.1.1 (D:123-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
ngnsilystqgndnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkgtg
cravlqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt

Sequence, based on observed residues (ATOM records): (download)

>d1dlpd2 b.78.1.1 (D:123-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]}
ngnsilystnhpqtlhatqslqlspyrlsmetdcnlvlfdrddrvwstntagkgtgcrav
lqpngrmdvltnqniavwtsgnsrsagryvfvlqpdrnlaiyggalwtt

SCOPe Domain Coordinates for d1dlpd2 are not available.

Timeline for d1dlpd2:

Domains from same chain:
(mouse over for more information)
d1dlpd1
Domains from other chains:
(mouse over for more information)
d1dlpa1, d1dlpa2, d1dlpb1, d1dlpb2, d1dlpc1, d1dlpc2, d1dlpe1, d1dlpe2, d1dlpf1, d1dlpf2