![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries) |
![]() | Domain d5cvua1: 5cvu A:15-122 [276903] Other proteins in same PDB: d5cvua2, d5cvub2, d5cvuc2, d5cvud2 automated match to d1kyze1 complexed with 55b, no3, sah |
PDB Entry: 5cvu (more details), 1.8 Å
SCOPe Domain Sequences for d5cvua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cvua1 a.4.5.0 (A:15-122) automated matches {Clarkia breweri [TaxId: 36903]} hssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnp eapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
Timeline for d5cvua1: