Lineage for d5cvub1 (5cvu B:9-122)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694648Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)
  8. 2694656Domain d5cvub1: 5cvu B:9-122 [276901]
    Other proteins in same PDB: d5cvua2, d5cvub2, d5cvuc2, d5cvud2
    automated match to d1kyze1
    complexed with 55b, no3, sah

Details for d5cvub1

PDB Entry: 5cvu (more details), 1.8 Å

PDB Description: sinpyl alcohol bound monolignol 4-o-methyltransferase 5
PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d5cvub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cvub1 a.4.5.0 (B:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq
lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

SCOPe Domain Coordinates for d5cvub1:

Click to download the PDB-style file with coordinates for d5cvub1.
(The format of our PDB-style files is described here.)

Timeline for d5cvub1: