![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies) |
![]() | Superfamily b.69.4: Trp-Asp repeat (WD-repeat) [50978] (1 family) ![]() |
![]() | Family b.69.4.1: Trp-Asp repeat (WD-repeat) [50979] (2 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50981] (8 PDB entries) |
![]() | Domain d1tbgd_: 1tbg D: [27652] Other proteins in same PDB: d1tbge_, d1tbgf_, d1tbgg_, d1tbgh_ |
PDB Entry: 1tbg (more details), 2.1 Å
SCOP Domain Sequences for d1tbgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbgd_ b.69.4.1 (D:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)} mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya mhwgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d1tbgd_: