Lineage for d1tbgf_ (1tbg F:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies) 
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) 
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries) 
Domain d1tbgf_: 1tbg F: [19631]
Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_
Details for d1tbgf_
PDB Entry: 1tbg (more details), 2.1 Å
PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin
SCOP Domain Sequences for d1tbgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbgf_ a.137.3.1 (F:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk
SCOP Domain Coordinates for d1tbgf_:
Click to download the PDB-style file with coordinates for d1tbgf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tbgf_:
- d1tbgf_ appears in SCOP 1.57
- d1tbgf_ appears in the current release, SCOPe 2.08
View in 3D
