Lineage for d1tbge_ (1tbg E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6849Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies)
  4. 6863Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
  5. 6864Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 6865Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 6866Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries)
  8. 6868Domain d1tbge_: 1tbg E: [19630]
    Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbge_

PDB Entry: 1tbg (more details), 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin

SCOP Domain Sequences for d1tbge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbge_ a.137.3.1 (E:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

SCOP Domain Coordinates for d1tbge_:

Click to download the PDB-style file with coordinates for d1tbge_.
(The format of our PDB-style files is described here.)

Timeline for d1tbge_: