Class a: All alpha proteins [46456] (138 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies) |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries) |
Domain d1tbge_: 1tbg E: [19630] Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_ |
PDB Entry: 1tbg (more details), 2.1 Å
SCOP Domain Sequences for d1tbge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbge_ a.137.3.1 (E:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)} apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped knpfkelk
Timeline for d1tbge_: