SCOPe 2.08: Domain d2n18b1: 2n18 B:-4-103

Lineage for d2n18b1 (2n18 B:-4-103)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
   Uniprot P00044

8. Domain d2n18b1: 2n18 B:-4-103 [272659]
   Other proteins in same PDB: d2n18a_, d2n18b2
   automated match to d1s6vb_
   complexed with hec, hem

Details for d2n18b1

PDB Entry: 2n18

PDB Description: dominant form of the low-affinity complex of yeast cytochrome c and cytochrome c peroxidase

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2n18b1:

Sequence; same for both SEQRES and ATOM records:

>d2n18b1 a.3.1.1 (B:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate

Timeline for d2n18b1:

• d2n18b1 first appeared in SCOPe 2.05, called d2n18b_
  
• d2n18b1 appears in SCOPe 2.07