Lineage for d2n18b1 (2n18 B:-4-103)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2303867Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (78 PDB entries)
    Uniprot P00044
  8. 2303957Domain d2n18b1: 2n18 B:-4-103 [272659]
    Other proteins in same PDB: d2n18a_, d2n18b2
    automated match to d1s6vb_
    complexed with hec, hem

Details for d2n18b1

PDB Entry: 2n18 (more details)

PDB Description: dominant form of the low-affinity complex of yeast cytochrome c and cytochrome c peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2n18b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n18b1 a.3.1.1 (B:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d2n18b1:

Click to download the PDB-style file with coordinates for d2n18b1.
(The format of our PDB-style files is described here.)

Timeline for d2n18b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n18b2